PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr5g017950.1
Common NameMTR_5g017950
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family LBD
Protein Properties Length: 319aa    MW: 34853.8 Da    PI: 7.0887
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr5g017950.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.11.3e-4281071100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk+lrrkC+++Cv+apyfp ++p++fa+vhk+FGasnv kll++l+ ++r+da++sl+yeAear+rdPvyG+vg+i+ lq++l+  + el
  Medtr5g017950.1   8 PCAACKFLRRKCTQECVFAPYFPPDNPQRFAYVHKVFGASNVAKLLNELNATQRDDAVKSLAYEAEARLRDPVYGCVGLISLLQHKLRAIQGEL 101
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      + +k+e
  Medtr5g017950.1 102 NNAKKE 107
                      *99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.4837108IPR004883Lateral organ boundaries, LOB
PfamPF031951.5E-428105IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MSSSSNSPCA ACKFLRRKCT QECVFAPYFP PDNPQRFAYV HKVFGASNVA KLLNELNATQ  60
RDDAVKSLAY EAEARLRDPV YGCVGLISLL QHKLRAIQGE LNNAKKELAT YIGPQALQGI  120
PTTILQQQQQ HNNPFGNSLY PYNGGVPTVT AGAQMVIRDP QQTPAAAQHQ ILEAQQLAAA  180
VAAREQQEIF RTFENQQQQQ QQEFLRFSGG FDVDSVSNSS AGGGFNQVSP VSAVGVAADQ  240
LSPSLALGSF DNTYHHMQQA QQGQGGESHN LHHHHNHHHH LPLQAQLLLP PQQKQAQPQT  300
HQQQTESEEC RSVGLGPC*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU0135150.0CU013515.2 Medicago truncatula chromosome 5 clone mth2-106f22, COMPLETE SEQUENCE.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003611797.10.0lateral organ boundaries (LOB) domain protein
SwissprotQ9FKZ32e-69LBD36_ARATH; LOB domain-containing protein 36
TrEMBLG7K8300.0G7K830_MEDTR; Lateral organ boundaries (LOB) domain protein
STRINGGLYMA11G06210.21e-132(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.18e-66ASYMMETRIC LEAVES 2-like 1
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]